PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400014220
Common NameLOC102586537
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 338aa    MW: 37069.5 Da    PI: 9.298
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400014220genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.11.3e-19222255134
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                           C++C +tkTp+WR+gp g+ktLCnaCG++yr+ +
  PGSC0003DMP400014220 222 CTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGR 255
                           *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004016.6E-15216266IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.358220252IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.6E-14221253IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.28E-14221279No hitNo description
CDDcd002029.35E-17221278No hitNo description
PfamPF003202.0E-17222255IPR000679Zinc finger, GATA-type
PROSITE patternPS003440222247IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MTMVEHGGGY MDGVPTGPIV DDDFDDILNF LDMPMESLEE DGLGGVEWDV SESKGFGPIP  60
TDALMDFPPM PQGNIGNRRV NAVAKSHPHP PIKFTEVQGT GTFQTQSPVS VLEGSNSCSG  120
GKSIPIKHDI VIPVRPRSKR ARPSAVNPWV LMAPISSTRV ASKKISDARK TKEKRRRLSL  180
LSGAKEPMKN YVQQINDAAL PLSDVYKKKI TSTQQSSFFK KCTHCEVTKT PQWREGPLGP  240
KTLCNACGVR YRSGRLFPEY RPAASPTFVP SVHSNSHRKV VEMRKKTLYG TGEVEEPPKV  300
IMGRKSEALP EPTIVADPAM SPAPEFVPMS SYLFDVY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173177KRRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340186.10.0PREDICTED: GATA transcription factor 11-like
TrEMBLM1AE860.0M1AE86_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000208760.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31342149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.22e-41GATA transcription factor 11
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]